COX18 anticorps

N° du produit ABIN635096

L’anticorps Lapin Polyclonal anti-COX18 a été validé pour WB. Il convient pour détecter COX18 dans des échantillons de Humain.

Aperçu rapide pour COX18 anticorps (ABIN635096)

Antigène: COX18 (Cytochrome C Oxidase Assembly Homolog 18 (COX18))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COX18 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-COX18 anticorps

Purification: Affinity purified

Immunogène: COX18 antibody was raised using a synthetic peptide corresponding to a region with amino acids LCSSFVGLSQNLLLRSPGFRQLCRIPSTKSDSETPYKDIFAAFNTKFISR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

COX18 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this COX18 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COX18

Antigène: COX18 (Cytochrome C Oxidase Assembly Homolog 18 (COX18))

Autre désignation: COX18

Sujet: COX18 is required for the insertion of integral membrane proteins into the mitochondrial inner membrane. COX18 is essential for the activity and assembly of cytochrome c oxidase. COX18 plays a central role in the translocation and export of the C-terminal part of the COX2 protein into the mitochondrial intermembrane space.

Poids moléculaire: 37 kDa (MW of target protein)